mastercard disabled — all other credit cards and payment options are available

0

GLP-1 (C)

This is a synthetic peptide analog supplied in lyophilized powder form for use in qualified laboratory environments. The compound is intended for in vitro and analytical research applications involving peptide interaction and assay-based systems under controlled experimental conditions. This material is provided strictly for research use only and has not been evaluated for clinical, therapeutic, or diagnostic use.

Select Weight

Select Amount

-
+
$115.00

Order More, Save More

Free Shipping on All Orders $175+

Product Usage: For Research Use Only – Not for Human or Veterinary Use

Pure Health Peptides products are supplied to qualified research professionals and institutional users for in vitro laboratory research only. KYC verification is required prior to order fulfillment, and we reserve the right to refuse orders that do not meet buyer qualification criteria. These products are not drugs, foods, cosmetics, or dietary supplements, have not been evaluated by the FDA, and are not intended for human or animal use. Any such use is prohibited and may violate federal, state, or local law. By purchasing, the buyer represents and warrants that the product will be used solely for in vitro research.

Description

Research Area:
Metabolics
Chemical Information:
  • Molecular Formula: C194H312N54O59S2
  • Molecular Weight: 4409.01 g/mol
  • Sequence: XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP  *)
  • *) Note: Where “X” denotes a non-standard or modified N-terminal residue (γ-glutamyl-linked moiety) as defined by the compound structure.
  • Molecular Structure:
Molecular Structure
Product Description:
This is a synthetic peptide analog supplied in lyophilized powder form for use in qualified laboratory environments. The compound is intended for in vitro and analytical research applications involving peptide interaction and assay-based systems under controlled experimental conditions. This material is provided strictly for research use only and has not been evaluated for clinical, therapeutic, or diagnostic use.
Product Designation Note:
This product is identified using an internal designation for cataloging and differentiation purposes. It is not marketed, labeled, or represented as any approved pharmaceutical or therapeutic compound..
Research Applications:
In laboratory research settings, this peptide analog is utilized in controlled experimental systems to support investigation of:
  • Peptide interaction characterization in defined assay systems
  • Receptor binding interaction modeling in controlled experimental environments
  • Structure–property relationship analysis
  • Stability, degradation, and binding behavior under experimental conditions
  • Comparative evaluation of peptide analog modifications

These research activities are conducted in non-clinical, non-therapeutic contexts.

Storage and Handling:
  • Store the lyophilized powder at -20°C.
  • Once reconstituted, store at 2-8°C and use promptly.
  • Maintain aseptic handling practices to ensure product quality and sterility.
Product Specifications:
  • Purity: ≥99% (HPLC Certified)
  • Appearance: Lyophilized white powder
  • Solubility: Soluble in suitable laboratory agents
Compliance Notice:
This compound is FOR RESEARCH USE ONLY. It is not intended for human or veterinary use. This product has not been evaluated by the FDA. Misuse of this product is strictly prohibited and may violate federal, state, or local laws. By purchasing this product, buyer represents and warrants that it will be used only for in vitro research purposes.
Group 3330 1024x716 1

Certificate of Analysis

At Pure Health Peptides, transparency is key. Every batch is third-party tested in the USA, with Certificates of Analysis (COAs) readily available for verification, giving researchers confidence in their work.

related products

subscribe to newsletter

Be the first to know about new products & special
offers from Pure Health Peptides!

    Your Cart
    Your cart is emptyReturn to Shop

    Welcome to

    Pure Health Peptides

    All products sold by Pure Health Peptides LLC are intended for laboratory and research purposes only. They are not for human consumption, veterinary use, or medical applications. You must be 21 years or older to purchase. Misuse of these products is strictly prohibited.

    You must be 21 or older to access this site.